Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | IGF2BP1/IMP1 Rabbit mAb |
---|---|
Catalog No. | A25715 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC66817 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 101-200 of human IGF2BP1/IMP1(NP_006537.3). |
---|---|
Sequence | LAQYGTVENCEQVNTESETAVVNVTYSNREQTRQAIMKLNGHQLENHALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRL |
Gene ID | |
Swiss Prot | |
Synonyms | IMP1; ZBP1; CRDBP; IMP-1; CRD-BP; VICKZ1 |
Calculated MW | 49kDa/63kDa |
Observed MW | 64kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | K-562, 293F |
Cellular location | Cell projection, Cytoplasm, Nucleus, axon, dendrite, dendritic spine, filopodium, growth cone, lamellipodium, perinuclear region, CRD-mediated mRNA stability complex, cytoplasm, cytoplasmic stress granule, cytosol, nucleoplasm, nucleus, P-body, perinuclear region of cytoplasm. |
Customer validation | WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A25715? Please let us know so that we can cite the reference in this datasheet.