제품 > 항체 > 단일클론항체(mAb)

IGF2BP1/IMP1 Rabbit mAb (A25715)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using IGF2BP1/IMP1 Rabbit mAb (A25715) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
Negative control (NC): U-937
Exposure time: 1 s.

ABclonal:Immunohistochemistry - IGF2BP1/IMP1 Rabbit mAb (A25715)

Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using IGF2BP1/IMP1 Rabbit mAb (A25715) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using IGF2BP1/IMP1 Rabbit mAb (A25715) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human testis tissue using IGF2BP1/IMP1 Rabbit mAb (A25715) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using IGF2BP1/IMP1 Rabbit mAb (A25715) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - IGF2BP1/IMP1 Rabbit mAb (A25715)

Confocal imaging of Hep G2 cells using IGF2BP1/IMP1 Rabbit mAb (A25715, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

ABclonal:Immunoprecipitation - IGF2BP1/IMP1 Rabbit mAb (A25715)

Immunoprecipitation of IGF2BP1/IMP1 from 500 µg extracts of 293F cells was performed using 2 µg of IGF2BP1/IMP1 Rabbit mAb (A25715). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X non-reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using IGF2BP1/IMP1 Rabbit mAb (A25715) at a dilution of 1:1000.

Overview

Product name	IGF2BP1/IMP1 Rabbit mAb
Catalog No.	A25715
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC66817

Background

This gene encodes a member of the insulin-like growth factor 2 mRNA-binding protein family. The protein encoded by this gene contains four K homology domains and two RNA recognition motifs. It functions by binding to the mRNAs of certain genes, including insulin-like growth factor 2, beta-actin and beta-transducin repeat-containing protein, and regulating their translation. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 101-200 of human IGF2BP1/IMP1(NP_006537.3).
Sequence	LAQYGTVENCEQVNTESETAVVNVTYSNREQTRQAIMKLNGHQLENHALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRL
Gene ID
Swiss Prot
Synonyms	IMP1; ZBP1; CRDBP; IMP-1; CRD-BP; VICKZ1
Calculated MW	49kDa/63kDa
Observed MW	64kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IHC-P 1:200 - 1:800 IF/ICC 1:200 - 1:800 IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	K-562, 293F
Cellular location	Cell projection, Cytoplasm, Nucleus, axon, dendrite, dendritic spine, filopodium, growth cone, lamellipodium, perinuclear region, CRD-mediated mRNA stability complex, cytoplasm, cytoplasmic stress granule, cytosol, nucleoplasm, nucleus, P-body, perinuclear region of cytoplasm.