제품 > 항체 > 다중클론항체(pAb)

IGF2BP1/IMP1 Rabbit pAb (A13581)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using IGF2BP1/IMP1 Rabbit pAb (A13581) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunoprecipitation - IGF2BP1/IMP1 Rabbit pAb (A13581)

Immunoprecipitation analysis of 200 μg extracts of K562 cells using 1 μg IGF2BP1/IMP1 antibody (A13581). Western blot was performed from the immunoprecipitate using IGF2BP1/IMP1 antibody (A13581) at a dilution of 1:1000.

Overview

Product name	IGF2BP1/IMP1 Rabbit pAb
Catalog No.	A13581
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the insulin-like growth factor 2 mRNA-binding protein family. The protein encoded by this gene contains four K homology domains and two RNA recognition motifs. It functions by binding to the mRNAs of certain genes, including insulin-like growth factor 2, beta-actin and beta-transducin repeat-containing protein, and regulating their translation. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 478-577 of human IGF2BP1/IMP1 (NP_006537.3).
Sequence	NFFGPKEEVKLETHIRVPASAAGRVIGKGGKTVNELQNLTAAEVVVPRDQTPDENDQVIVKIIGHFYASQMAQRKIRDILAQVKQQHQKGQSNQAQARRK
Gene ID
Swiss Prot
Synonyms	IMP1; ZBP1; CRDBP; IMP-1; CRD-BP; VICKZ1; IGF2BP1/IMP1
Calculated MW	63kDa
Observed MW	70kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	Jurkat, K-562, HepG2, HeLa, NIH/3T3, A-549, HL-60, Mouse liver
Cellular location	Cell projection, Cytoplasm, Nucleus, axon, dendrite, dendritic spine, filopodium, growth cone, lamellipodium, perinuclear region.
Customer validation	RIP(Danio rerio,Homo sapiens,Mus musculus)