제품 > 항체 > 단일클론항체(mAb)

IGF2BP2/IMP2 Rabbit mAb (A5189)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using IGF2BP2/IGF2BP2/IMP2 Rabbit mAb (A5189) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - IGF2BP2/IMP2 Rabbit mAb (A5189)

Immunohistochemistry analysis of paraffin-embedded Human colon using IGF2BP2/IGF2BP2/IMP2 Rabbit mAb (A5189) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunoprecipitation - IGF2BP2/IMP2 Rabbit mAb (A5189)

Immunoprecipitation analysis of 300 μg extracts of HepG2 cells using 3 μg IGF2BP2/IMP2 antibody (A5189). Western blot was performed from the immunoprecipitate using IGF2BP2/IMP2 antibody (A5189) at a dilution of 1:1000.

Overview

Product name	IGF2BP2/IMP2 Rabbit mAb
Catalog No.	A5189
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1203

Background

This gene encodes a protein that binds the 5' UTR of insulin-like growth factor 2 (IGF2) mRNA and regulates its translation. It plays an important role in metabolism and variation in this gene is associated with susceptibility to diabetes. Alternative splicing and promoter usage results in multiple transcript variants. Related pseudogenes are found on several chromosomes.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 500-595 of human IGF2BP2/IMP2 (NP_001007226.1).
Sequence	NFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTSAEVIVPRDQTPDENEEVIVRIIGHFFASQTAQRKIREIVQQVKQQEQKYPQGVAS
Gene ID
Swiss Prot
Synonyms	IMP2; IMP-2; VICKZ2; IGF2BP2/IMP2
Calculated MW	66kDa/62kDa
Observed MW	65kDa/70kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:4000 IHC-P 1:100 - 1:1000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	HT-29, 293T, Hep G2
Cellular location	Cytoplasm, Nucleus.