제품 > 항체 > 다중클론항체(pAb)

IGF2BP2/IMP2 Rabbit pAb (A14103)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using IGF2BP2/IMP2 Rabbit pAb (A14103) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 10s.

ABclonal:Immunofluorescence - IGF2BP2/IMP2 Rabbit pAb (A14103)

Immunofluorescence analysis of U2OS cells using IGF2BP2/IMP2 Rabbit pAb (A14103) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - IGF2BP2/IMP2 Rabbit pAb (A14103)

Immunoprecipitation analysis of 300 μg extracts of Jurkat cells using 3 μg IGF2BP2/IMP2 antibody (A14103). Western blot was performed from the immunoprecipitate using IGF2BP2/IMP2 antibody (A14103) at a dilution of 1:500.

Overview

Product name	IGF2BP2/IMP2 Rabbit pAb
Catalog No.	A14103
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a protein that binds the 5' UTR of insulin-like growth factor 2 (IGF2) mRNA and regulates its translation. It plays an important role in metabolism and variation in this gene is associated with susceptibility to diabetes. Alternative splicing and promoter usage results in multiple transcript variants. Related pseudogenes are found on several chromosomes.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 500-599 of human IGF2BP2/IMP2 (NP_006539.3).
Sequence	NFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTSAEVIVPRDQTPDENEEVIVRIIGHFFASQTAQRKIREIVQQVKQQEQKYPQGVASQRSK
Gene ID
Swiss Prot
Synonyms	IMP2; IMP-2; VICKZ2; IGF2BP2/IMP2
Calculated MW	66kDa
Observed MW	70kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	HeLa, Jurkat, Mouse testis, Mouse ovary, Rat testis
Cellular location	Cytoplasm, Nucleus