제품 > 항체 > 다중클론항체(pAb)

Icam5 Rabbit pAb (A15732)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of lysates from Mouse brain, using Icam5 Rabbit pAb (A15732) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

Overview

Product name	Icam5 Rabbit pAb
Catalog No.	A15732
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable integrin binding activity. Acts upstream of or within phagocytosis. Located in plasma membrane. Is expressed in brain. Orthologous to human ICAM5 (intercellular adhesion molecule 5).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 586-786 of mouse Icam5 (NP_032345.2).
Sequence	VEGSGKLFSCEVDGKPEPRVECVGSEGASEGIVLPLVSSNSGPRNSMTPGNLSPGIYLCNATNRHGSTVKTVVVSAESPPQMDESSCPSHQTWLEGAEATALACSARGRPSPRVHCSREGAARLERLQVSREDAGTYRCVATNAHGTDSRTVTVGVEYRPVVAELAASPPSVRPGGNFTLTCRAEAWPPAQISWRAPPGAL
Gene ID
Swiss Prot
Synonyms	TLN; CD50; Tlcn; Icam3; ICAM-3; ICAM-5; Icam5
Calculated MW	97kDa
Observed MW	140kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse brain
Cellular location	Membrane, Single-pass type I membrane protein