Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse
Flow cytometry: 1X10^6 CHO cells (negative control, left) and CHO (Transfection, right) cells were surface-stained with PE Rabbit anti-Mouse CD50/ICAM-3 mAb (A26793, 5 μl/Test, orange line) or PE Rabbit IgG isotype control (A24172, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
| Product name | PE Rabbit anti-Mouse CD50/ICAM-3 mAb |
|---|---|
| Catalog No. | A26793 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC69845-PE |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 32-227 of mouse CD50/ICAM-3 (NP_032345.2). |
|---|---|
| Sequence | EPFWADLQPRVALVERGGSLWLNCSTNCPRPERGGLETSLRRNGTQRGLRWLARQLVDIREPETQPVCFFRCARRTLQARGLIRTFQRPDRVELVPLPSWQPVGENFTLSCRVPGAGPRASLTLTLLRGGQELIRRSFVGEPPRARGAMLTARVLARREDHRVNFSCLAELDLRPHGLGLFANSSAPRQLRTFAMP |
| Gene ID | |
| Swiss Prot | |
| Synonyms | TLN; CD50; Tlcn; Icam3; ICAM-3; ICAM-5 |
| Calculated MW | 97kDa |
| Observed MW |
| Reactivity | Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3. |
| Key application | Flow Cytometry |
| Positive samples | |
| Cellular location | Membrane, Single-pass type I membrane protein. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
