Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | Interferon alpha 2 (IFN-α2) Rabbit pAb |
---|---|
Catalog No. | A17316 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human Interferon alpha 2 (IFN-α2) (NP_000596.2). |
---|---|
Sequence | DETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
Gene ID | |
Swiss Prot | |
Synonyms | IFNA; IFNA2B; leIF A; IFN-alphaA; IFN-alpha-2; Interferon alpha 2 (IFN-α2) |
Calculated MW | 22kDa |
Observed MW | 15kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | U-937, SP2/0 |
Cellular location | extracellular region, extracellular space. |
* For research use only. Not for therapeutic or diagnostic purposes.