제품 > 항체 > 단일클론항체(mAb)

JunD Rabbit mAb (A5433)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

CUT&Tag was performed using the CUT&Tag Assay Kit (pAG-Tn5) for Illumina(RK20265) from 10⁵ Hep G2 cells with 1 μg JunD Rabbit mAb (A5433), along with a Goat Anti-Rabbit IgG(H+L). The CUT&Tag results indicate the enrichment pattern of JunD in representative gene loci (TP53INP2), as shown in figure.

ABclonal:Western blot - JunD Rabbit mAb (A5433)

Western blot analysis of various lysates using JunD Rabbit mAb (A5433) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunoprecipitation - JunD Rabbit mAb (A5433)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg JunD antibody (A5433). Western blot was performed from the immunoprecipitate using JunD antibody (A5433) at a dilution of 1:1000.

ABclonal:Chromatin Immunoprecipitation - JunD Rabbit mAb (A5433)

Chromatin immunoprecipitation analysis of extracts of HepG2 cells, using JunD antibody (A5433) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Overview

Product name	JunD Rabbit mAb
Catalog No.	A5433
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1408

Background

The protein encoded by this intronless gene is a member of the JUN family, and a functional component of the AP1 transcription factor complex. This protein has been proposed to protect cells from p53-dependent senescence and apoptosis. Alternative translation initiation site usage results in the production of different isoforms (PMID:12105216).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human JunD (P17535).
Sequence	SPELERLIIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPGELAPAAAAPEAPVYANLSSY
Gene ID
Swiss Prot
Synonyms	AP-1; JunD
Calculated MW	35kDa
Observed MW	38kDa/42kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements. ChIP 5μg antibody for 10μg-15μg of Chromatin CUT&Tag 10⁵ cells /1 μg
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	HeLa, HT-1080
Cellular location	Nucleus.
Customer validation	Other(Homo sapiens) WB(Homo sapiens)