제품 > 항체 > 단일클론항체(mAb)

[KD Validated] Calreticulin Rabbit mAb (A20986)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using [KD Validated] Calreticulin Rabbit mAb (A20986) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of lysates from wild type (WT) and Calreticulin knockdown (KD) 293T cells using [KD Validated] Calreticulin Rabbit mAb (A20986) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - [KD Validated] Calreticulin Rabbit mAb (A20986)

Immunohistochemistry analysis of paraffin-embedded Human lung adenocarcinoma tissue using [KD Validated] Calreticulin Rabbit mAb (A20986) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using [KD Validated] Calreticulin Rabbit mAb (A20986) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using [KD Validated] Calreticulin Rabbit mAb (A20986) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using [KD Validated] Calreticulin Rabbit mAb (A20986) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using [KD Validated] Calreticulin Rabbit mAb (A20986) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - [KD Validated] Calreticulin Rabbit mAb (A20986)

Confocal imaging of Hep G2 cells using [KD Validated] Calreticulin Rabbit mAb (A20986, dilution 1:50)(Red) . DAPI was used for nuclear staining (blue). Objective: 40x.

Confocal imaging of NIH/3T3 cells using [KD Validated] Calreticulin Rabbit mAb (A20986, dilution 1:50) (Red). DAPI was used for nuclear staining (blue). Objective: 40x.

Overview

Product name	[KD Validated] Calreticulin Rabbit mAb
Catalog No.	A20986
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC51269

Background

Calreticulin is a highly conserved chaperone protein which resides primarily in the endoplasmic reticulum, and is involved in a variety of cellular processes, among them, cell adhesion. Additionally, it functions in protein folding quality control and calcium homeostasis. Calreticulin is also found in the nucleus, suggesting that it may have a role in transcription regulation. Systemic lupus erythematosus is associated with increased autoantibody titers against calreticulin. Recurrent mutations in calreticulin have been linked to various neoplasms, including the myeloproliferative type.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 18-203 of human Calreticulin (NP_004334.1).
Sequence	EPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFL
Gene ID
Swiss Prot
Synonyms	RO; CRT; SSA; cC1qR; HEL-S-99n; [KD Validated] Calreticulin
Calculated MW	47kDa
Observed MW	55kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IHC-P 1:1000 - 1:5000 IF/ICC 1:50 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa, SH-SY5Y, NIH/3T3, Mouse liver, C6, 293T
Cellular location	Cell surface, Cytoplasm, Endoplasmic reticulum lumen, Sarcoplasmic reticulum lumen, Secreted, cytosol, Extracellular matrix, Extracellular space.
Customer validation	IHC(Homo sapiens, Mus musculus) IF(Mus musculus) IF(Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구후성유전학 & 핵 신호전달RNA 결합

[KD Validated] Calreticulin Rabbit mAb images

Western blot - [KD Validated] Calreticulin Rabbit mAb (A20986)

Immunohistochemistry - [KD Validated] Calreticulin Rabbit mAb (A20986)

Immunofluorescence - [KD Validated] Calreticulin Rabbit mAb (A20986)

Confocal imaging of Hep G2 cells using [KD Validated] Calreticulin Rabbit mAb (A20986, dilution 1:50)(Red) . DAPI was used for nuclear staining (blue). Objective: 40x.

Immunofluorescence - [KD Validated] Calreticulin Rabbit mAb (A20986)

Confocal imaging of NIH/3T3 cells using [KD Validated] Calreticulin Rabbit mAb (A20986, dilution 1:50) (Red). DAPI was used for nuclear staining (blue). Objective: 40x.

* For research use only. Not for therapeutic or diagnostic purposes.