제품 > 항체 > 다중클론항체(pAb)

[KD Validated] eIF4E Rabbit pAb (A2162)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using eIF4E Rabbit pAb (A2162) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 10s.

Western blot analysis of various lysates, using [KD Validated] eIF4E Rabbit pAb (A2162) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of lysates from wild type(WT) and eIF4E knockdown (KD) 293T cells, using [KD Validated] eIF4E Rabbit pAb (A2162) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of various lysates, using [KD Validated] eIF4E Rabbit pAb (A2162) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.

Western blot analysis of lysates from wild type (WT) and eIF4E knockdown (KD) 293T cells using [KD Validated] eIF4E Rabbit pAb (A2162) at 1:1400 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
Exposure time: 10 s.

ABclonal:Immunohistochemistry - [KD Validated] eIF4E Rabbit pAb (A2162)

Immunohistochemistry analysis of paraffin-embedded Human lung cancer using [KD Validated] eIF4E Rabbit pAb (A2162) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human stomach using [KD Validated] eIF4E Rabbit pAb (A2162) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat testis using [KD Validated] eIF4E Rabbit pAb (A2162) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse liver using [KD Validated] eIF4E Rabbit pAb (A2162) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human liver using [KD Validated] eIF4E Rabbit pAb (A2162) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - [KD Validated] eIF4E Rabbit pAb (A2162)

Immunofluorescence analysis of U2OS cells using eIF4E Rabbit pAb (A2162) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U2OS cells using [KD Validated] eIF4E Rabbit pAb (A2162) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HeLa cells using [KD Validated] eIF4E Rabbit pAb (A2162) at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HepG2 cells using [KD Validated] eIF4E Rabbit pAb (A2162) at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 cells using [KD Validated] eIF4E Rabbit pAb (A2162) at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-12 cells using [KD Validated] eIF4E Rabbit pAb (A2162) at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - [KD Validated] eIF4E Rabbit pAb (A2162)

Immunoprecipitation analysis of 200 μg extracts of 293T cells, using 3 μg [KD Validated] eIF4E Rabbit pAb (A2162). Western blot was performed from the immunoprecipitate using [KD Validated] eIF4E Rabbit pAb at a dilution of 1:1000.

Review

Overview

Product name	[KD Validated] eIF4E Rabbit pAb
Catalog No.	A2162
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a component of the eukaryotic translation initiation factor 4F complex, which recognizes the 7-methylguanosine cap structure at the 5' end of messenger RNAs. The encoded protein aids in translation initiation by recruiting ribosomes to the 5'-cap structure. Association of this protein with the 4F complex is the rate-limiting step in translation initiation. This gene acts as a proto-oncogene, and its expression and activation is associated with transformation and tumorigenesis. Several pseudogenes of this gene are found on other chromosomes. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF4E (NP_001959.1).
Sequence	MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEP
Gene ID
Swiss Prot
Synonyms	CBP; EIF4F; AUTS19; EIF4E1; eIF-4E; EIF4EL1; 4E
Calculated MW	25kDa
Observed MW	25kDa/28kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:100 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	293T, HeLa, K-562
Cellular location	Cytoplasm, P-body.
Customer validation	(RD cell, Human cells, HEK293T, A172) IF(Homo sapiens) WB(Homo sapiens, Microplitis bicoloratus bracovirus, Mus musculus) IF(Homo sapiens) IP(Homo sapiens) Other(Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KD Validated] eIF4E Rabbit pAb images

Western blot - [KD Validated] eIF4E Rabbit pAb (A2162)

Immunohistochemistry - [KD Validated] eIF4E Rabbit pAb (A2162)

Immunofluorescence - [KD Validated] eIF4E Rabbit pAb (A2162)

Immunoprecipitation - [KD Validated] eIF4E Rabbit pAb (A2162)

* For research use only. Not for therapeutic or diagnostic purposes.

Submit an review for A2162

Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr

Reviews List

Product Protocols

References for [KD Validated] eIF4E Rabbit pAb (A2162)

Product:

[KD Validated] eIF4E Rabbit pAb

Journal:

PLOS Pathogens

Application:

IF:

5.5

Species:

Homo sapiens

PMID:

29518158

Title:

Inclusion bodies of human parainfluenza virus type 3 inhibit antiviral stress granule formation by shielding viral RNAs

References for [KD Validated] eIF4E Rabbit pAb (A2162)

Product:

[KD Validated] eIF4E Rabbit pAb

Journal:

Cancer Res

Application:

IF:

12.5

Species:

Homo sapiens

PMID:

32522823

Title:

A Genome-Wide Pooled shRNA Screen Identifies PPP2R2A as a Predictive Biomarker for the Response to ATR and CHK1 Inhibitors

References for [KD Validated] eIF4E Rabbit pAb (A2162)

Product:

[KD Validated] eIF4E Rabbit pAb

Journal:

Developmental and comparative immunology

Application:

IF:

2.7

Species:

Microplitis bicoloratus bracovirus

PMID:

30776419

Title:

Microplitis bicoloratus bracovirus modulates innate immune suppression through the eIF4E-eIF4A axis in the insect Spodoptera litura.

References for [KD Validated] eIF4E Rabbit pAb (A2162)

Product:

[KD Validated] eIF4E Rabbit pAb

Journal:

International journal of molecular sciences

Application:

IF:

5.6

Species:

Mus musculus

PMID:

36902337

Title:

Elevated Hippocampal CRMP5 Mediates Chronic Stress-Induced Cognitive Deficits by Disrupting Synaptic Plasticity, Hindering AMPAR Trafficking, and Triggering Cytokine Release - PMC

References for [KD Validated] eIF4E Rabbit pAb (A2162)

Product:

[KD Validated] eIF4E Rabbit pAb

Journal:

PLoS pathogens

Application:

WB, IF

IF:

5.5

Species:

Homo sapiens

PMID: