제품 > 항체 > 단일클론항체(mAb)

eIF4E Rabbit mAb (A19044)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates using eIF4E Rabbit mAb (A19044) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

ABclonal:Immunoprecipitation - eIF4E Rabbit mAb (A19044)

Immunoprecipitation analysis of 600 μg extracts of Mouse testis using 3 μg eIF4E antibody (A19044). Western blot was performed from the immunoprecipitate using eIF4E (A19044) at a dilution of 1:500.

Overview

Product name	eIF4E Rabbit mAb
Catalog No.	A19044
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0447

Background

The protein encoded by this gene is a component of the eukaryotic translation initiation factor 4F complex, which recognizes the 7-methylguanosine cap structure at the 5' end of messenger RNAs. The encoded protein aids in translation initiation by recruiting ribosomes to the 5'-cap structure. Association of this protein with the 4F complex is the rate-limiting step in translation initiation. This gene acts as a proto-oncogene, and its expression and activation is associated with transformation and tumorigenesis. Several pseudogenes of this gene are found on other chromosomes. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 118-217 of human eIF4E (P06730).
Sequence	NKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
Gene ID
Swiss Prot
Synonyms	CBP; EIF4F; AUTS19; EIF4E1; eIF-4E; EIF4EL1; eIF4E
Calculated MW	25kDa
Observed MW	25kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	Mouse testis, Mouse liver, Rat testis
Cellular location	Cytoplasm, P-body
Customer validation	WB(Homo sapiens)