제품 > 항체 > 단일클론항체(mAb)

[KO Validated] GSK3α Rabbit mAb (A19060)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from wild type (WT) and GSK3α knockout (KO) HeLa cells, using [KO Validated] GSK3α Rabbit mAb (A19060) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of lysates from Rat lung, using [KO Validated] GSK3α Rabbit mAb (A19060) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of lysates from Mouse brain, using [KO Validated] GSK3α Rabbit mAb (A19060) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunoprecipitation - [KO Validated] GSK3α Rabbit mAb (A19060)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg GSK3α antibody (A19060). Western blot was performed from the immunoprecipitate using GSK3α antibody (A19060) at a dilution of 1:1000.

Overview

Product name	[KO Validated] GSK3α Rabbit mAb
Catalog No.	A19060
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0462

Background

This gene encodes a multifunctional Ser/Thr protein kinase that is implicated in the control of several regulatory proteins including glycogen synthase, and transcription factors, such as JUN. It also plays a role in the WNT and PI3K signaling pathways, as well as regulates the production of beta-amyloid peptides associated with Alzheimer's disease.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GSK3α (P49840).
Sequence	MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGVGASSSGGGPGGSGGGGSGGPGAGTSFPPPGVKLGRDSGKV
Gene ID
Swiss Prot
Synonyms	GSK3 alpha; GSK3A; 3α
Calculated MW	51kDa
Observed MW	51kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	HeLa, Rat lung, Mouse brain
Cellular location	apical dendrite, axon, beta-catenin destruction complex, cytoplasm, cytosol, mitochondrion, nucleus, postsynapse, proximal dendrite.
Customer validation	WB(Homo sapiens, Mus musculus) ChIP(Mus musculus) WB(Mus musculus)