제품 > 항체 > 다중클론항체(pAb)

[KO Validated] HSP27/HSPB1 Rabbit pAb (A16332)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts from normal (control) and HSP27/HSP27/HSPB1 knockout (KO) HeLa cells, using HSP27/HSP27/HSPB1 antibody (A16332) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

Western blot analysis of extracts of HeLa cells, using HSP27/HSP27/HSPB1 antibody (A16332) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - [KO Validated] HSP27/HSPB1 Rabbit pAb (A16332)

Immunofluorescence analysis of HeLa cells using HSP27/HSP27/HSPB1 antibody (A16332) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	[KO Validated] HSP27/HSPB1 Rabbit pAb
Catalog No.	A16332
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the small heat shock protein (HSP20) family of proteins. In response to environmental stress, the encoded protein translocates from the cytoplasm to the nucleus and functions as a molecular chaperone that promotes the correct folding of other proteins. This protein plays an important role in the differentiation of a wide variety of cell types. Expression of this gene is correlated with poor clinical outcome in multiple human cancers, and the encoded protein may promote cancer cell proliferation and metastasis, while protecting cancer cells from apoptosis. Mutations in this gene have been identified in human patients with Charcot-Marie-Tooth disease and distal hereditary motor neuropathy.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human HSP27/HSP27/HSPB1 (NP_001531.1).
Sequence	MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEI
Gene ID
Swiss Prot
Synonyms	CMT2F; HMN2B; HSP27; HSP28; Hsp25; SRP27; HS.76067; HEL-S-102
Calculated MW	23kDa
Observed MW	27kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa
Cellular location	Cytoplasm, Nucleus, cytoskeleton, spindle
Customer validation	IHC(Homo sapiens) WB(Rattus norvegicus)