제품 > 항체 > 단일클론항체(mAb)

[KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit mAb (A19068)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from A549 cells, using [KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit mAb (A19068) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of various lysates, using [KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit mAb (A19068) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of lysates from wild type(WT) and Integrin alpha 2 (ITGA2/CD49b) knockout (KO) 293T cells, using [KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit mAb (A19068) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - [KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit mAb (A19068)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using [KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit mAb (A19068) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human breast tissue using [KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit mAb (A19068) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using [KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit mAb (A19068) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using [KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit mAb (A19068) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using [KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit mAb (A19068) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using [KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit mAb (A19068) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Overview

Product name	[KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit mAb
Catalog No.	A19068
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0457

Background

This gene encodes the alpha subunit of a transmembrane receptor for collagens and related proteins. The encoded protein forms a heterodimer with a beta subunit and mediates the adhesion of platelets and other cell types to the extracellular matrix. Loss of the encoded protein is associated with bleeding disorder platelet-type 9. Antibodies against this protein are found in several immune disorders, including neonatal alloimmune thrombocytopenia. This gene is located adjacent to a related alpha subunit gene. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1082-1181 of human Integrin alpha 2 (ITGA2/CD49b) (P17301).
Sequence	GTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDEKAEVPTGVIIGSIIAGILLLLALVAILWKLGFFKRKYEKMTKNPDEIDETTELSS
Gene ID
Swiss Prot
Synonyms	BR; GPIa; CD49B; HPA-5; VLA-2; VLAA2; b)
Calculated MW	129kDa
Observed MW	150kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IHC-P 1:200 - 1:800 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	293T, A549, Mouse large intestine, Mouse lung, Mouse spleen, Rat lung
Cellular location	Membrane, Single-pass type I membrane protein.