제품 > 항체 > 다중클론항체(pAb)

[KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit pAb (A7629)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using [KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit pAb (A7629) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Western blot analysis of lysates from wild type (WT) and Integrin alpha 2 (ITGA2/CD49b) knockout (KO) 293T cells, using [KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit pAb (A7629) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - [KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit pAb (A7629)

Immunohistochemistry analysis of paraffin-embedded Human lung cancer using [KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit pAb (A7629) at dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human placenta using [KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit pAb (A7629) at dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human tonsil using [KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit pAb (A7629) at dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - [KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit pAb (A7629)

Immunofluorescence analysis of U2OS cells using [KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit pAb (A7629) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	[KO Validated] Integrin alpha 2 (ITGA2/CD49b) Rabbit pAb
Catalog No.	A7629
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes the alpha subunit of a transmembrane receptor for collagens and related proteins. The encoded protein forms a heterodimer with a beta subunit and mediates the adhesion of platelets and other cell types to the extracellular matrix. Loss of the encoded protein is associated with bleeding disorder platelet-type 9. Antibodies against this protein are found in several immune disorders, including neonatal alloimmune thrombocytopenia. This gene is located adjacent to a related alpha subunit gene. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 30-162 of human Integrin alpha 2 (ITGA2/CD49b) (NP_002194.2).
Sequence	YNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLILTRNMGTGGFLTCGPLWAQQCGNQYYTTGVCSDISPDFQLSASF
Gene ID
Swiss Prot
Synonyms	BR; GPIa; CD49B; HPA-5; VLA-2; VLAA2; b)
Calculated MW	129kDa
Observed MW	150kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	293T, HeLa, HT-1080
Cellular location	Membrane, Single-pass type I membrane protein
Customer validation	IHC(Mus musculus) WB(Homo sapiens)