Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | [KO Validated] LDHA Rabbit mAb |
---|---|
Catalog No. | A0861 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2669 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human LDHA (P00338). |
---|---|
Sequence | VWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGI |
Gene ID | |
Swiss Prot | |
Synonyms | LDHM; GSD11; PIG19; HEL-S-133P; HA |
Calculated MW | 37kDa |
Observed MW | 37kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | 293T, MCF7 |
Cellular location | Cytoplasm. |
Customer validation | WB(Mus musculus, Homo sapiens, Mus musculus, Rattus norvegicus ) IHC(Homo sapiens, Rattus norvegicus ) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A0861? Please let us know so that we can cite the reference in this datasheet.