제품 > 항체 > 단일클론항체(mAb)

[KO Validated] NRF2 Rabbit mAb (A25327)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from Saos-2 cells using NRF2 Rabbit mAb (A25327) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Western blot analysis of lysates from HeLa cells using NRF2 Rabbit mAb (A25327) at 1:500 dilution. Wild type (WT) and NRF2 knockout (KO) HeLa cells were treated by MG132(50 μM) at 37℃ for 90 minutes.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 30 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - [KO Validated] NRF2 Rabbit mAb (A25327)

Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using NRF2 Rabbit mAb (A25327) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using NRF2 Rabbit mAb (A25327) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using NRF2 Rabbit mAb (A25327) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using NRF2 Rabbit mAb (A25327) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using NRF2 Rabbit mAb (A25327) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - [KO Validated] NRF2 Rabbit mAb (A25327)

Confocal imaging of paraffin-embedded Human pancreas tissue using [KO Validated] NRF2 Rabbit mAb (A25327, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Overview

Product name	[KO Validated] NRF2 Rabbit mAb
Catalog No.	A25327
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC3264

Background

This gene encodes a transcription factor which is a member of a small family of basic leucine zipper (bZIP) proteins. The encoded transcription factor regulates genes which contain antioxidant response elements (ARE) in their promoters; many of these genes encode proteins involved in response to injury and inflammation which includes the production of free radicals. Multiple transcript variants encoding different isoforms have been characterized for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 505-605 of human NRF2 (NP_006155.2).
Sequence	GKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKPDVKKN
Gene ID
Swiss Prot
Synonyms	NRF2; HEBP1; Nrf-2; IMDDHH
Calculated MW	68kDa
Observed MW	97-100kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Saos-2, HeLa treated by MG132
Cellular location	Cytoplasm, Nucleus, cytosol.
Customer validation	IHC(Homo sapiens, Mus musculus) WB(Homo sapiens) WB(Mus musculus)