제품 > 항체 > 다중클론항체(pAb)

[KO Validated] PDK1/PDPK1 Rabbit pAb (A1665)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using [KO Validated] PDK1/PDPK1 Rabbit pAb (A1665) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Western blot analysis of lysates from wild type (WT) and PDK1/PDPK1 knockout (KO) HCT116 cells, using [KO Validated] PDK1/PDPK1 Rabbit pAb (A1665) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - [KO Validated] PDK1/PDPK1 Rabbit pAb (A1665)

Immunohistochemistry analysis of paraffin-embedded Rat brain using [KO Validated] PDK1/PDPK1 Rabbit pAb (A1665) at dilution of 1:200 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Overview

Product name	[KO Validated] PDK1/PDPK1 Rabbit pAb
Catalog No.	A1665
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables 3-phosphoinositide-dependent protein kinase activity; phospholipase activator activity; and phospholipase binding activity. Involved in several processes, including cell surface receptor signaling pathway; regulation of protein kinase activity; and regulation of signal transduction. Acts upstream of or within intracellular signal transduction. Located in cell projection; cytosol; and plasma membrane. Implicated in prostate cancer. Biomarker of lung non-small cell carcinoma.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 409-556 of human PDK1/PDPK1 (NP_002604.1).
Sequence	GSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ
Gene ID
Swiss Prot
Synonyms	PDK1; PDPK2; PDPK2P; PRO0461; K1
Calculated MW	63kDa
Observed MW	58-68kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HCT116, Mouse brain, Rat brain
Cellular location	Cell junction, Cell membrane, Cytoplasm, Nucleus, Peripheral membrane protein, focal adhesion.
Customer validation	WB(Homo sapiens, Mus musculus) IP(Homo sapiens, Mus musculus) IHC(Homo sapiens, Mus musculus) RIP(Homo sapiens) IF(Canis familiaris,Chlorocebus aethiops,Gallus gallus,Homo sapiens) WB(Canis familiaris,Chlorocebus aethiops,Gallus gallus,Homo sapiens)