Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | [KO Validated] PDK1/PDPK1 Rabbit pAb |
---|---|
Catalog No. | A1665 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 409-556 of human PDK1/PDPK1 (NP_002604.1). |
---|---|
Sequence | GSNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ |
Gene ID | |
Swiss Prot | |
Synonyms | PDK1; PDPK2; PDPK2P; PRO0461; K1 |
Calculated MW | 63kDa |
Observed MW | 58-68kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | HCT116, Mouse brain, Rat brain |
Cellular location | Cell junction, Cell membrane, Cytoplasm, Nucleus, Peripheral membrane protein, focal adhesion. |
Customer validation | WB(Homo sapiens, Mus musculus, Crassostrea gigas) IP(Homo sapiens, Mus musculus) IHC(Homo sapiens, Mus musculus) RIP(Homo sapiens) IF(Canis familiaris,Chlorocebus aethiops,Gallus gallus,Homo sapiens) WB(Canis familiaris,Chlorocebus aethiops,Gallus gallus,Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A1665? Please let us know so that we can cite the reference in this datasheet.