제품 > 항체 > 단일클론항체(mAb)

[KO Validated] PRMT4/CARM1 Rabbit mAb (A21106)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from MCF7 cells, using [KO Validated] PRMT4/CARM1 Rabbit mAb (A21106) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of various lysates using [KO Validated] PRMT4/CARM1 Rabbit mAb (A21106) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of lysates from wild type (WT) and PRMT4/CARM1 knockout (KO) 293T cells, using [KO Validated] PRMT4/CARM1 Rabbit mAb (A21106) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunoprecipitation - [KO Validated] PRMT4/CARM1 Rabbit mAb (A21106)

Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg PRMT4/CARM1 antibody (A21106). Western blot was performed from the immunoprecipitate using PRMT4/CARM1 antibody (A21106) at a dilution of1:1000.

Overview

Product name	[KO Validated] PRMT4/CARM1 Rabbit mAb
Catalog No.	A21106
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC52397

Background

This gene belongs to the protein arginine methyltransferase (PRMT) family. The encoded enzyme catalyzes the methylation of guanidino nitrogens of arginyl residues of proteins. The enzyme acts specifically on histones and other chromatin-associated proteins and is involved in regulation of gene expression. The enzyme may act in association with other proteins or within multi-protein complexes and may play a role in cell type-specific functions and cell lineage specification. A related pseudogene is located on chromosome 9.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 486-603 of human PRMT4/CARM1 (NP_954592.1).
Sequence	GSHYTSPSENMWNTGSTYNLSSGMAVAGMPTAYDLSSVIASGSSVGHNNLIPLANTGIVNHTHSRMGSIMSTGIVQGSSGAQGSGGGSTSAHYAVNSQFTMGGPAISMASPMSIPTNT
Gene ID
Swiss Prot
Synonyms	PRMT4; M1
Calculated MW	66kDa
Observed MW	60kDa/63kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	MCF7, 293T, Mouse testis, Rat testis
Cellular location	Cytoplasm, Nucleus