제품 > 항체 > 다중클론항체(pAb)

[KO Validated] SEC61B Rabbit pAb (A15788)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from wild type (WT) and SEC61B knockout (KO) 293T cells, using [KO Validated] SEC61B Rabbit pAb (A15788) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - [KO Validated] SEC61B Rabbit pAb (A15788)

Immunofluorescence analysis of L929 cells using [KO Validated] SEC61B Rabbit pAb (A15788) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	[KO Validated] SEC61B Rabbit pAb
Catalog No.	A15788
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. Oligomers of the Sec61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER membrane. This complex consists of three membrane proteins- alpha, beta, and gamma. This gene encodes the beta-subunit protein. The Sec61 subunits are also observed in the post-ER compartment, suggesting that these proteins can escape the ER and recycle back. There is evidence for multiple polyadenylated sites for this transcript.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-96 of human SEC61B (NP_006799.1).
Sequence	MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS
Gene ID
Swiss Prot
Synonyms	SEC61B; 1B
Calculated MW	10kDa
Observed MW	12kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, HepG2, SH-SY5Y, Mouse stomach, Rat liver, Rat stomach
Cellular location	Endoplasmic reticulum membrane, Single-pass membrane protein
Customer validation	WB(Chlorocebus aethiops , Homo sapiens, Mus musculus) IF(Homo sapiens)