Review (1)Publications (7) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | [KO Validated] SIRT1 Rabbit mAb |
---|---|
Catalog No. | A19667 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0146 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 648-747 of human SIRT1 (Q96EB6). |
---|---|
Sequence | NRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS |
Gene ID | |
Swiss Prot | |
Synonyms | SIR2; SIR2L1; SIR2alpha; T1 |
Calculated MW | 82kDa |
Observed MW | 130kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | HeLa |
Cellular location | Cytoplasm, Mitochondrion, Nucleus, Nucleus, PML body. |
Customer validation | (PC-3、MOLT-4、MCF-7) WB(Homo sapiens) IF(Mus musculus) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A19667? Please let us know so that we can cite the reference in this datasheet.