제품 > 항체 > 단일클론항체(mAb)

[KO Validated] SMARCC1/BAF155 Rabbit mAb (A4275)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using SMARCC1/BAF155 Rabbit mAb (A4275) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Western blot analysis of lysates from wild type (WT) and SMARCC1/BAF155 knockout (KO) 293T cells using [KO Validated] SMARCC1/BAF155 Rabbit mAb (A4275) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

ABclonal:Immunofluorescence - [KO Validated] SMARCC1/BAF155 Rabbit mAb (A4275)

Immunofluorescence analysis of NIH-3T3 cells using SMARCC1/BAF155 Rabbit mAb (A4275) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Chromatin Immunoprecipitation - [KO Validated] SMARCC1/BAF155 Rabbit mAb (A4275)

Chromatin immunoprecipitation analysis of extracts of MCF7 beta-estradiol cells, using SMARCC1/BAF155 antibody (A4275) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Overview

Product name	[KO Validated] SMARCC1/BAF155 Rabbit mAb
Catalog No.	A4275
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0948

Background

The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and contains a predicted leucine zipper motif typical of many transcription factors.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 700-800 of human SMARCC1/BAF155 (Q92922).
Sequence	AFLASVVDPRVASAAAKAALEEFSRVREEVPLELVEAHVKKVQEAARASGKVDPTYGLESSCIAGTGPDEPEKLEGAEEEKMEADPDGQQPEKAENKVENE
Gene ID
Swiss Prot
Synonyms	HYC5; Rsc8; SRG3; SWI3; BAF155; CRACC1; 55
Calculated MW	123kDa
Observed MW	155kDa/

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements. ChIP 5μg antibody for 10μg-15μg of Chromatin
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, HepG2, Mouse brain, Mouse testis, 293T
Cellular location	Nucleus.