Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Rat
Product name | [KO Validated] Smad5 Rabbit mAb |
---|---|
Catalog No. | A22749 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC55344 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 186-260 of human Smad5 (NP_005894.3). |
---|---|
Sequence | PLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRDV |
Gene ID | |
Swiss Prot | |
Synonyms | DWFC; JV5-1; MADH5; d5 |
Calculated MW | 52kDa |
Observed MW | 60kDa |
Reactivity | Human, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | 293T |
Cellular location | Cytoplasm, Nucleus |
Customer validation | (293T, C2C12 cell lines,C2C12 Smad5 KO cell lines) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr