제품 > 항체 > 단일클론항체(mAb)

[KO Validated] Smad5 Rabbit mAb (A22749)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of lysates from wild type(WT) and Smad5 knockout (KO) 293T(KO) cells, using [KO Validated] Smad5 Rabbit mAb (A22749) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

Review

Overview

Product name	[KO Validated] Smad5 Rabbit mAb
Catalog No.	A22749
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC55344

Background

The protein encoded by this gene is involved in the transforming growth factor beta signaling pathway that results in an inhibition of the proliferation of hematopoietic progenitor cells. The encoded protein is activated by bone morphogenetic proteins type 1 receptor kinase, and may be involved in cancer. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 186-260 of human Smad5 (NP_005894.3).
Sequence	PLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRDV
Gene ID
Swiss Prot
Synonyms	DWFC; JV5-1; MADH5; d5
Calculated MW	52kDa
Observed MW	60kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	293T
Cellular location	Cytoplasm, Nucleus
Customer validation	(293T, C2C12 cell lines,C2C12 Smad5 KO cell lines)