제품 > 항체 > 단일클론항체(mAb)

Smad5 Rabbit mAb (A19117)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from K-562 cells, using Smad5 Rabbit mAb (A19117) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of lysates from C2C12 cells, using Smad5 Rabbit mAb (A19117) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunoprecipitation - Smad5 Rabbit mAb (A19117)

Immunoprecipitation analysis of 300 μg extracts of K-562 cells using 3 μg Smad5 antibody (A19117). Western blot was performed from the immunoprecipitate using Smad5 antibody (A19117) at a dilution of 1:1000.

Overview

Product name	Smad5 Rabbit mAb
Catalog No.	A19117
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0448

Background

The protein encoded by this gene is involved in the transforming growth factor beta signaling pathway that results in an inhibition of the proliferation of hematopoietic progenitor cells. The encoded protein is activated by bone morphogenetic proteins type 1 receptor kinase, and may be involved in cancer. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Smad5 (Q99717).
Sequence	STYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFT
Gene ID
Swiss Prot
Synonyms	DWFC; JV5-1; MADH5; Smad5
Calculated MW	52kDa
Observed MW	60kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	K-562, C2C12
Cellular location	Cytoplasm, Nucleus
Customer validation	WB(Mus musculus)