제품 > 항체 > 다중클론항체(pAb)

Smad5 Rabbit pAb (A0635)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from Rat lung, using Smad5 Rabbit pAb (A0635) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - Smad5 Rabbit pAb (A0635)

Immunohistochemistry analysis of paraffin-embedded Mouse brain using Smad5 Rabbit pAb (A0635) (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat brain using Smad5 Rabbit pAb (A0635) (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human esophagus using Smad5 Rabbit pAb (A0635) (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Overview

Product name	Smad5 Rabbit pAb
Catalog No.	A0635
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is involved in the transforming growth factor beta signaling pathway that results in an inhibition of the proliferation of hematopoietic progenitor cells. The encoded protein is activated by bone morphogenetic proteins type 1 receptor kinase, and may be involved in cancer. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 140-240 of human Smad5 (NP_005894.3).
Sequence	LVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQPNNTPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQP
Gene ID
Swiss Prot
Synonyms	DWFC; JV5-1; MADH5; Smad5
Calculated MW	52kDa
Observed MW	52kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:100 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Rat lung
Cellular location	Cytoplasm, Nucleus.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Smad5 Rabbit pAb images

Western blot - Smad5 Rabbit pAb (A0635)

Immunohistochemistry - Smad5 Rabbit pAb (A0635)

Immunohistochemistry analysis of paraffin-embedded Mouse brain using Smad5 Rabbit pAb (A0635) (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry - Smad5 Rabbit pAb (A0635)

Immunohistochemistry analysis of paraffin-embedded Rat brain using Smad5 Rabbit pAb (A0635) (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry - Smad5 Rabbit pAb (A0635)

* For research use only. Not for therapeutic or diagnostic purposes.