제품 > 항체 > 다중클론항체(pAb)

[KO Validated] TTC11/FIS1 Rabbit pAb (A21527)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various lysates, using TTC11/FIS1 antibody (A21527) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Western blot analysis of extracts from wild type(WT) and TTC11/FIS1 knockout (KO) HeLa cells, using TTC11/FIS1 antibody (A21527) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Overview

Product name	[KO Validated] TTC11/FIS1 Rabbit pAb
Catalog No.	A21527
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables identical protein binding activity. Involved in several processes, including calcium-mediated signaling using intracellular calcium source; cellular calcium ion homeostasis; and mitochondrion organization. Acts upstream of or within mitochondrion morphogenesis. Located in mitochondrion and peroxisome. Is integral component of mitochondrial outer membrane and integral component of peroxisomal membrane. Part of protein-containing complex. Biomarker of Alzheimer's disease.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-122 of human TTC11/FIS1 (NP_057152.2).
Sequence	MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDG
Gene ID
Swiss Prot
Synonyms	TTC11; CGI-135
Calculated MW	17kDa
Observed MW	17kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, HepG2, MCF7, Mouse brain, Mouse heart, Rat brain
Cellular location	Mitochondrion outer membrane, Peroxisome membrane, Single-pass membrane protein
Customer validation	WB(Homo sapiens, Mus musculus)