Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | [KO Validated] TTC11/FIS1 Rabbit mAb |
---|---|
Catalog No. | A19666 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC5010-03 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-122 of human TTC11/FIS1 (NP_057152.2). |
---|---|
Sequence | MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDG |
Gene ID | |
Swiss Prot | |
Synonyms | TTC11; CGI-135; S1 |
Calculated MW | 17kDa |
Observed MW | 15kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | HeLa, HepG2, Mouse heart, Rat spleen, Rat brain |
Cellular location | Mitochondrion outer membrane, Peroxisome membrane, Single-pass membrane protein. |
Customer validation | WB(Mus musculus, Rattus norvegicus, Sus scrofa, Homo sapiens, Rattus norvegicus) IHC(Mus musculus, Rattus norvegicus) IF(Mus musculus, Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19666? Please let us know so that we can cite the reference in this datasheet.