제품 > 항체 > 단일클론항체(mAb)

Lipocalin-2/NGAL Rabbit mAb (A24131)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of various lysates using Lipocalin-2/NGAL Rabbit mAb (A24131) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): Mouse brain.
Exposure time: 45s.

Overview

Product name	Lipocalin-2/NGAL Rabbit mAb
Catalog No.	A24131
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC64874

Background

Enables iron ion binding activity. Involved in innate immune response; positive regulation of cold-induced thermogenesis; and siderophore transport. Acts upstream of or within extrinsic apoptotic signaling pathway in absence of ligand; response to bacterium; and response to virus. Located in extracellular space. Is expressed in several structures, including genitourinary system; gut; liver; lung; and spleen. Human ortholog(s) of this gene implicated in intrahepatic cholangiocarcinoma and urinary tract infection. Orthologous to human LCN2 (lipocalin 2).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 21-200 of mouse Lipocalin-2/NGAL (NP_032517.1).
Sequence	QDSTQNLIPAPSLLTVPLQPDFRSDQFRGRWYVVGLAGNAVQKKTEGSFTMYSTIYELQENNSYNVTSILVRDQDQGCRYWIRTFVPSSRAGQFTLGNMHRYPQVQSYNVQVATTDYNQFAMVFFRKTSENKQYFKITLYGRTKELSPELKERFTRFAKSLGLKDDNIIFSVPTDQCIDN
Gene ID
Swiss Prot
Synonyms	24p3; AW212229; NRL; Sip24; Lipocalin-2/NGAL
Calculated MW	23kDa
Observed MW	23kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse uterus, Mouse spleen, Mouse ovary
Cellular location	Secreted, Cytoplasmic granule lumen, Cytoplasmic vesicle lumen.