Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | MAP2 Rabbit mAb |
---|---|
Catalog No. | A22206 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC56285 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human MAP2 (NP_002365.3). |
---|---|
Sequence | MADERKDEAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGEHGSQGTYSNTKENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKD |
Gene ID | |
Swiss Prot | |
Synonyms | MAP-2; MAP2A; MAP2B; MAP2C; MAP2 |
Calculated MW | 200kDa/199kDa/50kDa/59kDa |
Observed MW | 75kDa/ |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Rat brain, SH-SY5Y |
Cellular location | Cytoplasm, cytoskeleton, Cell projection, dendrite. |
Customer validation | IF(Gallus gallus, Homo sapiens) Cell culture(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A22206? Please let us know so that we can cite the reference in this datasheet.