Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of lysates from Rat brain, using MAP2 Rabbit mAb (A22206) at1:4000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Western blot analysis of various lysates using MAP2 Rabbit mAb (A22206)at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
Negative control (NC): U-937
Exposure time: 3 s.
Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using MAP2 Rabbit mAb (A22206) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using MAP2 Rabbit mAb (A22206) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human brain tissue using MAP2 Rabbit mAb (A22206) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Confocal imaging of SH-SYSY cells using MAP2 Rabbit mAb (A22206, dilution 1:200)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.
Confocal imaging of paraffin-embedded mouse brain using MAP2 Rabbit mAb (A22206, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.Perform microwave antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.
Confocal imaging of paraffin-embedded rat brain using MAP2 Rabbit mAb (A22206, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.Perform microwave antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.
| Product name | MAP2 Rabbit mAb |
|---|---|
| Catalog No. | A22206 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC56285 |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human MAP2 (NP_002365.3). |
|---|---|
| Sequence | MADERKDEAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGEHGSQGTYSNTKENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKD |
| Gene ID | |
| Swiss Prot | |
| Synonyms | MAP-2; MAP2A; MAP2B; MAP2C; MAP2 |
| Calculated MW | 200kDa/199kDa/50kDa/59kDa |
| Observed MW | 75kDa/ |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | Rat brain, SH-SY5Y |
| Cellular location | Cytoplasm, cytoskeleton, Cell projection, dendrite. |
| Customer validation | IF(Gallus gallus) Cell culture(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A22206? Please let us know so that we can cite the reference in this datasheet.
_WB_01.jpg?t=1715049019)
