Review (1)Publications (8) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates, using MAP2 Rabbit pAb (A2572) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded rat heart using MAP2 Rabbit pAb (A2572) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human kidney cancer using MAP2 Rabbit pAb (A2572) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse brain using MAP2 Rabbit pAb (A2572) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of paraffin-embedded rat brain using MAP2 Rabbit pAb (A2572) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of paraffin-embedded mouse brain using MAP2 Rabbit pAb (A2572) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | MAP2 Rabbit pAb |
|---|---|
| Catalog No. | A2572 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1510-1650 of human MAP2 (NP_002365.3). |
|---|---|
| Sequence | GGESALAPSVFKQAKDKVSDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTP |
| Gene ID | |
| Swiss Prot | |
| Synonyms | MAP-2; MAP2A; MAP2B; MAP2C; MAP2 |
| Calculated MW | 200kDa |
| Observed MW | 75kDa/280kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | SH-SY5Y, PC-12 |
| Cellular location | Cytoplasm, cytoskeleton |
| Customer validation | (mouse brain) WB(Rattus norvegicus, Other) IF(Mus musculus, Rattus norvegicus, Homo sapiens) IF(Other) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A2572? Please let us know so that we can cite the reference in this datasheet.
_WB_01.jpg?t=1715049019 "ABclonal:Western blot - MAP2 Rabbit pAb (A2572)")
_IF_01.jpg?t=1715049019 "ABclonal:Immunofluorescence - MAP2 Rabbit pAb (A2572)")
_IF_02.jpg?t=1715049019 "ABclonal:Immunofluorescence - MAP2 Rabbit pAb (A2572)")
