Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | MAPKAPK-2/MK2 Rabbit mAb |
---|---|
Catalog No. | A22183 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC55427 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human MAPKAPK-2/MK2 (NP_116584.2). |
---|---|
Sequence | MLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH |
Gene ID | |
Swiss Prot | |
Synonyms | MK2; MK-2; MAPKAP-K2 |
Calculated MW | 46kDa |
Observed MW | 47kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, A-431 |
Cellular location | Cytoplasm, Nucleus |
Customer validation | IP(Other) WB(Other) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A22183? Please let us know so that we can cite the reference in this datasheet.