Review (1)Publications (6) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of lysates from Rat spleen using MMP14/MT1-MMP Rabbit pAb (A2549) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using MMP14/MT1-MMP Rabbit pAb (A2549) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse kidney using MMP14/MT1-MMP Rabbit pAb (A2549) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat kidney using MMP14/MT1-MMP Rabbit pAb (A2549) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of HeLa cells using MMP14/MT1-MMP Rabbit pAb (A2549) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using MMP14/MT1-MMP Rabbit pAb (A2549) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 cells using MMP14/MT1-MMP Rabbit pAb (A2549) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | MMP14/MT1-MMP Rabbit pAb |
|---|---|
| Catalog No. | A2549 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 75-174 of human MMP14/MMP14/MT1-MMP (NP_004986.1). |
|---|---|
| Sequence | QVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQ |
| Gene ID | |
| Swiss Prot | |
| Synonyms | MMP-14; MMP-X1; MT-MMP; MT1MMP; MTMMP1; WNCHRS; MT1-MMP; MT-MMP 1; MMP14/MT1-MMP |
| Calculated MW | 66kDa |
| Observed MW | 60kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | Rat spleen |
| Cellular location | Cytoplasm, Melanosome, Membrane, Single-pass type I membrane protein. |
| Customer validation | (MDA-MB-231) WB(Mus musculus, Homo sapiens) IHC(Homo sapiens) IHC(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A2549? Please let us know so that we can cite the reference in this datasheet.
