Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | MMP2 Rabbit mAb |
---|---|
Catalog No. | A19080 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0432 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 500-600 of human MMP2 (P08253). |
---|---|
Sequence | RDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDP |
Gene ID | |
Swiss Prot | |
Synonyms | CLG4; MONA; CLG4A; MMP-2; TBE-1; MMP-II |
Calculated MW | 74kDa |
Observed MW | 70kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HCT116, U-87MG, Mouse lung, Rat lung |
Cellular location | Cytoplasm, Membrane, Mitochondrion, Nucleus, Secreted, extracellular matrix, extracellular space |
Customer validation | WB(Sanghuangporus vaninii, Homo sapiens, Mus musculus) IF(Homo sapiens) IHC(Homo sapiens) IF(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19080? Please let us know so that we can cite the reference in this datasheet.