제품 > 항체 > 단일클론항체(mAb)

Myelin oligodendrocyte glycoprotein Rabbit mAb (A3992)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates using Myelin oligodendrocyte glycoprotein Rabbit mAb (A3992) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - Myelin oligodendrocyte glycoprotein Rabbit mAb (A3992)

Immunofluorescence analysis of paraffin-embedded rat brain using Myelin oligodendrocyte glycoprotein Rabbit mAb (A3992) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Confocal imaging of frozen sections of Mouse brain using Myelin oligodendrocyte glycoprotein Rabbit mAb (A3992, dilution 1:100) followed by incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x.Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.

Overview

Product name	Myelin oligodendrocyte glycoprotein Rabbit mAb
Catalog No.	A3992
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0879

Background

The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Myelin oligodendrocyte glycoprotein (NP_996532.2).
Sequence	MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTEL
Gene ID
Swiss Prot
Synonyms	BTN6; BTNL11; MOGIG2; NRCLP7; Myelin oligodendrocyte glycoprotein
Calculated MW	28kDa
Observed MW	28kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Mouse brain, Rat brain
Cellular location	Cell membrane, Multi-pass membrane protein, Single-pass type I membrane protein.
Customer validation	WB(Mus musculus)