제품 > 항체 > 단일클론항체(mAb)

PE Rabbit anti-Human CD85j/ILT2 mAb (A24250)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 K-562 cells(negative control, left) and Daudi cells(right) were surface-stained with PE Rabbit anti-Human CD85j/ILT2 mAb(A24250, 5 μl/Test, orange line) or PE Rabbit IgG isotype control (5 μl/Test, blue line).Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 Daudi cells were surface-stained with PE Rabbit IgG isotype control (5 μl/Test, left) or PE Rabbit anti-Human CD85j/ILT2 mAb(A24250, 5 μl/Test, right).

Overview

Product name	PE Rabbit anti-Human CD85j/ILT2 mAb
Catalog No.	A24250
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC60700-PE

Background

This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 24-458 of human CD85j/ILT2 (NP_006660.4).
Sequence	GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTALWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVILQCDSQVAFDGFSLCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQGWMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRH
Gene ID
Swiss Prot
Synonyms	LILRB1; CD85J; ILT-2; ILT2; LIR-1; LIR1; MIR-7; MIR7; PIR-B; PIRB; leukocyte immunoglobulin like receptor B1
Calculated MW	49kDa/70kDa/71kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane, Secreted, Single-pass type I membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PE Rabbit anti-Human CD85j/ILT2 mAb images

Flow CytoMetry - PE Rabbit anti-Human CD85j/ILT2 mAb (A24250)

Flow cytometry:1X10^6 Daudi cells were surface-stained with PE Rabbit IgG isotype control (5 μl/Test, left) or PE Rabbit anti-Human CD85j/ILT2 mAb(A24250, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.