제품 > 항체 > 다중클론항체(pAb)

PGHS-2 Rabbit pAb (A24438)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates, using PGHS-2 Rabbit pAb (A24438) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

Overview

Product name	PGHS-2 Rabbit pAb
Catalog No.	A24438
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Prostaglandin-endoperoxide synthase (PTGS), also known as cyclooxygenase, is the key enzyme in prostaglandin biosynthesis, and acts both as a dioxygenase and as a peroxidase. There are two isozymes of PTGS: a constitutive PTGS1 and an inducible PTGS2, which differ in their regulation of expression and tissue distribution. This gene encodes the inducible isozyme. It is regulated by specific stimulatory events, suggesting that it is responsible for the prostanoid biosynthesis involved in inflammation and mitogenesis.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 505-604 of human COX2/PTGS2 (P35354).
Sequence	GETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKERSTEL
Gene ID
Swiss Prot
Synonyms	COX2; COX-2; PHS-2; PGG/HS; PGHS-2; hCox-2; GRIPGHS
Calculated MW	69kDa
Observed MW	70kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	A549, HeLa
Cellular location	Endoplasmic reticulum membrane, Microsome membrane, Peripheral membrane protein