Review (1)Publications (28) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | COX2/PTGS2 Rabbit mAb |
---|---|
Catalog No. | A3560 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0800 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 505-604 of human COX2/PTGS2 (P35354). |
---|---|
Sequence | GETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKERSTEL |
Gene ID | |
Swiss Prot | |
Synonyms | COX2; COX-2; PHS-2; PGG/HS; PGHS-2; hCox-2; GRIPGHS; COX2/PTGS2 |
Calculated MW | 69kDa |
Observed MW | 72kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | HeLa+LPS, RAW 264.7+LPS, Rat brain |
Cellular location | caveola, cytoplasm, endoplasmic reticulum, endoplasmic reticulum lumen, neuron projection. |
Customer validation | (Hela,NIH/3T3) WB(Rattus norvegicus, Mus musculus, Homo sapiens, Mus musculus, Gallus gallus) IHC(Mus musculus, Homo sapiens, Rattus norvegicus) IHC(Mus musculus) IHC(Homo sapiens, Mus musculus, Rattus norvegicus) IF(Rattus norvegicus) ELISA(Rattus norvegicus) IF(Mus musculus) Other(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A3560? Please let us know so that we can cite the reference in this datasheet.