제품 > 항체 > 단일클론항체(mAb)

PKR/EIF2AK2 Rabbit mAb (A19545)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of extracts of various cell lines, using PKR/EIF2AK2 antibody (A19545) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Overview

Product name	PKR/EIF2AK2 Rabbit mAb
Catalog No.	A19545
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0024

Background

The protein encoded by this gene is a serine/threonine protein kinase that is activated by autophosphorylation after binding to dsRNA. The activated form of the encoded protein can phosphorylate translation initiation factor EIF2S1, which in turn inhibits protein synthesis. This protein is also activated by manganese ions and heparin. The encoded protein plays an important role in the innate immune response against multiple DNA and RNA viruses.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 450-551 of human PKR/EIF2AK2 (P19525).
Sequence	GTLRYMSPEQISSQDYGKEVDLYALGLILAELLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWKKSPEKNERHTC
Gene ID
Swiss Prot
Synonyms	PKR; PRKR; DYT33; LEUDEN; EIF2AK1; PPP1R83
Calculated MW	62kDa
Observed MW	70kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HT-29, MCF7, SH-SY5Y, HepG2
Cellular location	Cytoplasm, Nucleus, perinuclear region
Customer validation	RIP(Mus musculus) WB(Danio rerio, Homo sapiens, Mus musculus)