제품 > 항체 > 다중클론항체(pAb)

PLA2G7 Rabbit pAb (A13864)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from Human serum, using PLA2G7 Rabbit pAb (A13864) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Overview

Product name	PLA2G7 Rabbit pAb
Catalog No.	A13864
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a secreted enzyme that catalyzes the degradation of platelet-activating factor to biologically inactive products. Defects in this gene are a cause of platelet-activating factor acetylhydrolase deficiency. Two transcript variants encoding the same protein have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 51-240 of human PLA2G7 (NP_005075.3).
Sequence	FGQTKIPRGNGPYSVGCTDLMFDHTNKGTFLRLYYPSQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNILRLLFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLYSAIGIDLASHGFIVAAVEHRDRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETHIRNEQVRQRAKECSQALSLILDID
Gene ID
Swiss Prot
Synonyms	PAFAD; PAFAH; LP-PLA2; LDL-PLA2; PLA2G7
Calculated MW	50kDa
Observed MW	55kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Human serum
Cellular location	Secreted, extracellular space
Customer validation	WB(Mus musculus)