제품 > 항체 > 다중클론항체(pAb)

PLP1 Rabbit pAb (A14251)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using PLP1 Rabbit pAb (A14251) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - PLP1 Rabbit pAb (A14251)

Perform microwave antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.Immunofluorescence analysis of paraffin-embedded rat brain using PLP1 Rabbit pAb (A14251) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	PLP1 Rabbit pAb
Catalog No.	A14251
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a transmembrane proteolipid protein that is the predominant component of myelin. The encoded protein may play a role in the compaction, stabilization, and maintenance of myelin sheaths, as well as in oligodendrocyte development and axonal survival. Mutations in this gene cause Pelizaeus-Merzbacher disease and spastic paraplegia type 2. Alternatively splicing results in multiple transcript variants, including the DM20 splice variant.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 102-148 of human PLP1 (NP_955772.1).
Sequence	GDYKTTICGKGLSATFVGITYALTVVWLLVFACSAVPVYIYFNTWTT
Gene ID
Swiss Prot
Synonyms	PLP; PMD; HLD1; MMPL; SPG2; GPM6C; PLP/DM20; PLP1
Calculated MW	30kDa
Observed MW	20-25kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Mouse brain
Cellular location	Cell membrane, Multi-pass membrane protein, Myelin membrane.
Customer validation	WB(Mus musculus)