제품 > 항체 > 단일클론항체(mAb)

Rig-I/DDX58 Rabbit mAb (A22478)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates, using Rig-I/DDX58 Rabbit mAb (A22478) at 1:2000 dilution.THP-1 cells were treated by LPS (1 μg/ml) at 37℃ for 6 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Western blot analysis of lysates from RAW264.7 cells, using Rig-I/DDX58 Rabbit mAb (A22478) at 1:2000 dilution.Raw264.7 cells were treated by LPS (1 μg/ml) at 37℃ for 8 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Overview

Product name	Rig-I/DDX58 Rabbit mAb
Catalog No.	A22478
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC54110

Background

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases which are implicated in a number of cellular processes involving RNA binding and alteration of RNA secondary structure. This gene encodes a protein containing RNA helicase-DEAD box protein motifs and a caspase recruitment domain (CARD). It is involved in viral double-stranded (ds) RNA recognition and the regulation of the antiviral innate immune response. Mutations in this gene are associated with Singleton-Merten syndrome 2.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 241-455 of human Rig-I/DDX58 (NP_055129.2).
Sequence	FKPRNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKKFPQGQKGKVVFFANQIPVYEQQKSVFSKYFERHGYRVTGISGATAENVPVEQIVENNDIIILTPQILVNNLKKGTIPSLSIFTLMIFDECHNTSKQHPYNMIMFNYLDQKLGGSSGPLPQVIGLTASVGVGDAKNTDEALDYICKLCASLDASVIATVKHNLEELEQVVYK
Gene ID
Swiss Prot
Synonyms	RIG1; DDX58; RIG-I; RLR-1; SGMRT2; Rig-I/DDX58
Calculated MW	107kDa
Observed MW	107kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	THP-1 treated by LPS, RAW264.7 treated by LPS
Cellular location	Cell junction, Cell projection, Cytoplasm, cytoskeleton, ruffle membrane, tight junction
Customer validation	WB(Homo sapiens)