제품 > 항체 > 다중클론항체(pAb)

Rig-I/DDX58 Rabbit pAb (A13407)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using Rig-I/DDX58 antibody (A13407) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

ABclonal:Immunofluorescence - Rig-I/DDX58 Rabbit pAb (A13407)

Immunofluorescence analysis of H9C2 cells using Rig-I/DDX58 antibody (A13407) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of L929 cells using Rig-I/DDX58 antibody (A13407) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U20S cells using Rig-I/DDX58 antibody (A13407) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	Rig-I/DDX58 Rabbit pAb
Catalog No.	A13407
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases which are implicated in a number of cellular processes involving RNA binding and alteration of RNA secondary structure. This gene encodes a protein containing RNA helicase-DEAD box protein motifs and a caspase recruitment domain (CARD). It is involved in viral double-stranded (ds) RNA recognition and the regulation of the antiviral innate immune response. Mutations in this gene are associated with Singleton-Merten syndrome 2.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 726-925 of human Rig-I/DDX58 (NP_055129.2).
Sequence	QTRGRGRARGSKCFLLTSNAGVIEKEQINMYKEKMMNDSILRLQTWDEAVFREKILHIQTHEKFIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKDFHFEKIPFDPAEMSK
Gene ID
Swiss Prot
Synonyms	RIG1; DDX58; RIG-I; RLR-1; SGMRT2
Calculated MW	107kDa
Observed MW	102-110kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HepG2, Mouse brain, Mouse ovary, Rat brain
Cellular location	Cell junction, Cell projection, Cytoplasm, cytoskeleton, ruffle membrane, tight junction
Customer validation	WB(Rattus norvegicus)