Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | S6 Ribosomal Protein (RPS6) Rabbit pAb |
---|---|
Catalog No. | A6058 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-130 of human RPS6 (NP_001001.2). |
---|---|
Sequence | MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKDIPGLTDTTVP |
Gene ID | |
Swiss Prot | |
Synonyms | S6; eS6; S6 Ribosomal Protein (RPS6) |
Calculated MW | 29kDa |
Observed MW | 32kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | SKOV3, Raji, HT-29, A-431, Mouse heart |
Cellular location | cytoplasm, cytoplasmic ribonucleoprotein granule, cytosol, cytosolic ribosome, endoplasmic reticulum, nucleolus, nucleoplasm, nucleus, perinuclear region of cytoplasm. |
Customer validation | WB(Mus musculus, Homo sapiens, Sus scrofa, Agrobacterium tumefaciens, Pelteobagrus fulvidraco, Saccharomyces cerevisiae) IHC(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A6058? Please let us know so that we can cite the reference in this datasheet.