제품 > 항체 > 다중클론항체(pAb)

SFPQ Rabbit pAb (A0958)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using SFPQ Rabbit pAb (A0958) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - SFPQ Rabbit pAb (A0958)

Immunohistochemistry analysis of paraffin-embedded human esophageal using SFPQ Rabbit pAb (A0958) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human placenta using SFPQ Rabbit pAb (A0958) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - SFPQ Rabbit pAb (A0958)

Immunofluorescence analysis of HeLa cells using SFPQ Rabbit pAb (A0958) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - SFPQ Rabbit pAb (A0958)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg SFPQ antibody (A0958). Western blot was performed from the immunoprecipitate using SFPQ antibody (A0958) at a dilution of 1:1000.

Overview

Product name	SFPQ Rabbit pAb
Catalog No.	A0958
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables DNA binding activity; histone deacetylase binding activity; and protein homodimerization activity. Involved in several processes, including alternative mRNA splicing, via spliceosome; positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway; and regulation of transcription by RNA polymerase II. Acts upstream of or within double-strand break repair via homologous recombination. Located in chromatin; nuclear matrix; and paraspeckles.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 578-707 of human SFPQ (NP_005057.1).
Sequence	MMIRQREMEEQMRRQREESYSRMGYMDPRERDMRMGGGGAMNMGDPYGSGGQKFPPLGGGGGIGYEANPGVPPATMSGSMMGSDMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEGPNKKPRF
Gene ID
Swiss Prot
Synonyms	PSF; POMP100; PPP1R140; SFPQ
Calculated MW	76kDa
Observed MW	115kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:100 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	OVCAR3, HeLa, Jurkat, HepG2, Mouse brain, Mouse liver, Mouse spleen, Rat brain
Cellular location	Cytoplasm, Nucleus matrix
Customer validation	WB(Homo sapiens) RIP(Homo sapiens)