Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | STAT1 Rabbit mAb |
---|---|
Catalog No. | A19563 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0042 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human STAT1 (P42224). |
---|---|
Sequence | MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQ |
Gene ID | |
Swiss Prot | |
Synonyms | CANDF7; IMD31A; IMD31B; IMD31C; ISGF-3; STAT91; STAT1 |
Calculated MW | 87kDa |
Observed MW | 87kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunoprecipitation |
Positive samples | HepG2, HeLa, Mouse thymus, Rat liver |
Cellular location | Cytoplasm, Nucleus. |
Customer validation | WB(Gallus gallus, Mus musculus, Homo sapiens, Mus musculus, Rattus norvegicus, Sus scrofa) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19563? Please let us know so that we can cite the reference in this datasheet.