Reviews (2)Publications (21) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of lysates from HeLa cells, using STAT1 Rabbit pAb (A12075) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of various lysates using STAT1 Rabbit pAb (A12075) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded Rat ovary using STAT1 Rabbit pAb (A12075) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of L929 cells using STAT1 Rabbit pAb (A12075) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 200 μg extracts of U-87MG cells using 3 μg STAT1 antibody (A12075). Western blot was performed from the immunoprecipitate using STAT1 antibody (A12075) at a dilution of 1:1000.
Immunoprecipitation analysis of 200 μg extracts of U-87MG cells using 3 μg STAT1 Rabbit pAb (A12075). Western blot was performed from the immunoprecipitate using STAT1 Rabbit pAb (A12075) at a dilition of 1:500.
| Product name | STAT1 Rabbit pAb |
|---|---|
| Catalog No. | A12075 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 650-750 of human STAT1 (NP_009330.1). |
|---|---|
| Sequence | NYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTTDNLLPMSPEEFDEVSRIVGSVEFDSMMNTV |
| Gene ID | |
| Swiss Prot | |
| Synonyms | CANDF7; IMD31A; IMD31B; IMD31C; ISGF-3; STAT91; STAT1 |
| Calculated MW | 87kDa |
| Observed MW | 91kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
| Positive samples | HeLa, Mouse spleen, Rat spleen |
| Cellular location | Cytoplasm, Nucleus. |
| Customer validation | (HeLa cells, Human chronic myeloid leukemia cells) WB(Mus musculus, Homo sapiens) Co-IP(Mus musculus) IP(Mus musculus) ChIP(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A12075? Please let us know so that we can cite the reference in this datasheet.
