제품 > 항체 > 단일클론항체(mAb)

UAP56/DDX39B Rabbit mAb (A9749)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using UAP56/DDX39B Rabbit mAb (A9749) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of lysates from rat lung, using UAP56/DDX39B Rabbit mAb (A9749) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - UAP56/DDX39B Rabbit mAb (A9749)

Immunohistochemistry analysis of UAP56/DDX39B in paraffin-embedded mouse liver tissue using UAP56/DDX39B Rabbit mAb (A9749) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of UAP56/DDX39B in paraffin-embedded mouse lung tissue using UAP56/DDX39B Rabbit mAb (A9749) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of UAP56/DDX39B in paraffin-embedded human colon tissue using UAP56/DDX39B Rabbit mAb (A9749) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of UAP56/DDX39B in paraffin-embedded rat spleen tissue using UAP56/DDX39B Rabbit mAb (A9749) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of UAP56/DDX39B in paraffin-embedded human lung tissue using UAP56/DDX39B Rabbit mAb (A9749) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of UAP56/DDX39B in paraffin-embedded mouse brain tissue using UAP56/DDX39B Rabbit mAb (A9749) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	UAP56/DDX39B Rabbit mAb
Catalog No.	A9749
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1731

Background

This gene encodes a member of the DEAD box family of RNA-dependent ATPases that mediate ATP hydrolysis during pre-mRNA splicing. The encoded protein is an essential splicing factor required for association of U2 small nuclear ribonucleoprotein with pre-mRNA, and it also plays an important role in mRNA export from the nucleus to the cytoplasm. This gene belongs to a cluster of genes localized in the vicinity of the genes encoding tumor necrosis factor alpha and tumor necrosis factor beta. These genes are all within the human major histocompatibility complex class III region. Mutations in this gene may be associated with rheumatoid arthritis. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on both chromosomes 6 and 11. Read-through transcription also occurs between this gene and the upstream ATP6V1G2 (ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G2) gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 310-428 of human UAP56/DDX39B (Q13838).
Sequence	QNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR
Gene ID
Swiss Prot
Synonyms	BAT1; UAP56; D6S81E; UAP56/DDX39B
Calculated MW	49kDa
Observed MW	49kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, MCF7, Mouse brain, Mouse spleen, Mouse thymus, Rat lung
Cellular location	Cytoplasm, Nucleus, Nucleus speckle
Customer validation	WB(Homo sapiens)