Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Western blot analysis of various lysates using VDR Rabbit pAb (A2194) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunofluorescence analysis of HeLa cells using VDR Rabbit pAb (A2194) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using VDR Rabbit pAb (A2194) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U2OS cells using VDR Rabbit pAb (A2194) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HeLa cells using VDR Rabbit pAb (A2194) at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | VDR Rabbit pAb |
|---|---|
| Catalog No. | A2194 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human VDR (NP_000367.1). |
|---|---|
| Sequence | MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEV |
| Gene ID | |
| Swiss Prot | |
| Synonyms | NR1I1; PPP1R163; VDR |
| Calculated MW | 48kDa |
| Observed MW | 48kDa/50kDa |
| Reactivity | Human, Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | HeLa, MCF7, K-562, Mouse liver |
| Cellular location | Nucleus. |
| Customer validation | WB(Homo sapiens, Mus musculus) IF(Mus musculus, Homo sapiens) IHC(Mus musculus, Gallus gallus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A2194? Please let us know so that we can cite the reference in this datasheet.
