제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Cat CD3G mAb (A22490)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Cat

Flow cytometry: 1X10^6 293F cells (negative control, left) and 293F (Transfection, right) cells were surface-stained with ABflo® 488 Rabbit anti-Cat CD3G mAb (A22490, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells was used as blank control (red line).

Overview

Product name	ABflo® 488 Rabbit anti-Cat CD3G mAb
Catalog No.	A22490
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC55138-ABf488

Background

The protein encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. Defects in this gene are associated with T cell immunodeficiency.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 23-116 of cat CD3G (XP_003992456.3).
Sequence	QSKQEIPVVRVNSDREDGSVLLTCESPDKDVKWFQDGKEMTPHKKNKNIQNLGSSIKDPRGIYWCQGSKNRSRTLQVYFRMCQNCIELSRATVS
Gene ID
Swiss Prot
Synonyms	T3G; IMD17; CD3GAMMA; CD3-GAMMA
Calculated MW	20kDa
Observed MW

Applications

Reactivity	Cat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane