Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Cat
Product name | ABflo® 647 Rabbit anti-Cat CD3G mAb |
---|---|
Catalog No. | A22491 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC55138-ABf647 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 23-116 of cat CD3G (XP_003992456.3). |
---|---|
Sequence | QSKQEIPVVRVNSDREDGSVLLTCESPDKDVKWFQDGKEMTPHKKNKNIQNLGSSIKDPRGIYWCQGSKNRSRTLQVYFRMCQNCIELSRATVS |
Gene ID | |
Swiss Prot | |
Synonyms | T3G; IMD17; CD3GAMMA; CD3-GAMMA |
Calculated MW | 20kDa |
Observed MW |
Reactivity | Cat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3. |
Key application | Flow Cytometry |
Positive samples | |
Cellular location | Cell membrane |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.